SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QJK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QJK6
Domain Number 1 Region: 92-219
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-21
Family cAMP-binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 227-295,409-471
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000415
Family cAMP-binding domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QJK6
Sequence length 576
Comment (tr|G3QJK6|G3QJK6_GORGO) Cyclic nucleotide binding domain containing 2 {ECO:0000313|Ensembl:ENSGGOP00000002603} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CNBD2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRRHMVTYAWQLLKKELGLYQLAMDIIIMIRVCKMFRQGLRGFREYQIIETAHWKHPIFS
FWDKKMQSRVTFDTMDFIAEEGHFPPKAIQIMQKKPSLRTEDEIQAVCNILQVLHSYRNY
AEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAITKDEDGSSAFLDPHPKL
LHKGSCFGETDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRK
MELFASWSDEKLWQLVAMAKIEKFSYGQLISKDFGESPFIMFISKGSCEVLRLLDLGASP
SYHRWIWQHLELIDDRPLKTHLSEYSPMERFKEFQIKSYPLQDFSSLKLLHLKKAWGLQG
TSFSRKIRTSGDTLPKMLGPKIQSRPAQSIKCAMINTKLGELPKEAAVGAYVKVHTVEQG
EILGLHQAFLPEGECDTRPLILMSLGNELIRIRKEIFYELIDNDDEMIKKLLKLNIAFPS
DEDMCQKFLQQNSWNIFRKDLLQLLVEPCQSQLFTPNRPKKKEIYNPKSVVLDLCSINKT
TKPRYPIFMAPQKYLPPLRIVQAIKAPRYKIRELLA
Download sequence
Identical sequences G3QJK6
XP_018872602.1.27298 ENSGGOP00000002603 ENSGGOP00000002603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]