SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QJR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QJR7
Domain Number 1 Region: 277-325
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QJR7
Sequence length 331
Comment (tr|G3QJR7|G3QJR7_GORGO) Spondin 2 {ECO:0000313|Ensembl:ENSGGOP00000002670} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SPON2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MENPSPAAALGKALCALLLATLGAAGQPLGGESVCSARAPAKYSITFTGKWSQTAFPKQY
PLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSV
HAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQA
ALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVT
LVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGPCGRLGTKS
RTRYVRVQPANNGSPCPELEEEAECVPDNCV
Download sequence
Identical sequences G3QJR7 H2QP32
ENSPTRP00000027253 ENSGGOP00000002670 9598.ENSPTRP00000027253 ENSPTRP00000027253 ENSGGOP00000002670 XP_004038367.1.27298 XP_009445472.1.37143 XP_016808203.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]