SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QJY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QJY3
Domain Number 1 Region: 31-139
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.81e-36
Family Cystatins 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QJY3
Sequence length 141
Comment (tr|G3QJY3|G3QJY3_GORGO) Cystatin {ECO:0000256|RuleBase:RU362130} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CST1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MARHLSTLLLLLATLAVALAWSPKEEDRIILGGIYDADLNDEWVQRALHFAISEYNKATK
DDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQLNLDTCAFHEQPELQKKQLCSF
EIYEVPWENRRSLVKSRCQEA
Download sequence
Identical sequences G3QJY3
ENSGGOP00000002743 ENSGGOP00000002743 XP_004061957.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]