SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QK50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QK50
Domain Number 1 Region: 18-346
Classification Level Classification E-value
Superfamily L domain-like 8.5e-68
Family Internalin LRR domain 0.043
Further Details:      
 
Domain Number 2 Region: 366-516,577-628
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000785
Family G proteins 0.0081
Further Details:      
 
Domain Number 3 Region: 634-696
Classification Level Classification E-value
Superfamily Polo-box domain 0.0000667
Family Swapped Polo-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QK50
Sequence length 1010
Comment (tr|G3QK50|G3QK50_GORGO) Malignant fibrous histiocytoma amplified sequence 1 {ECO:0000313|Ensembl:ENSGGOP00000002818} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MFHAS1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
AGADALESPASPQLVLPANLGDIEALNLGNNGLEEVPEGLGSALGSLRVLVLRRNRFARL
PPAVAELGHHLTELDVSHNRLTALGAEVVSALRELRKLNLSHNQLPALPAQLGALAHLEE
LDVSFNRLAHLPDSLSCLSRLRTLDVDHNQLTAFPRQLLQLAALEELDVSSNRLRGLPED
ISALRALKILWLSGAELGTLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSS
NLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELT
GLEELVLQGNQIAVLPDHFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHS
QPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPPSPPPVSKGIEVTS
WTADASRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLATYEPSHFPTTVGSFLHR
VGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIALQEKHDAEGLSRLAKVVDEALAR
DFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVCCRDPRHLRRLRDKL
LSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRLQS
ALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDILNVFFQRDPSLLLHKLLLGTSGEGKA
EGESSPPMARSTPSQELLRATQLHQYVEGFLLHGLLPAHVIRLLLKPHVQAQQDLQLLLE
LLEKMGLCYCLNKHKGKPLNGSTAWYKFPCYVQNEVPHAEAWINGTNLAGQSFVAEQLQI
EYSFPFTFPPGLFARYSVQINSHVVHRSDGKFQIFAYRGKVPVVVSYRPAKGVLQPDTLS
IASHASLPNIWTAWQAITPLVEELNVLLQEWPGLHYTVHILCSKCLKRGSPNPHAFPGEL
LSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHRNQ
Download sequence
Identical sequences G3QK50
ENSGGOP00000002818 ENSGGOP00000002818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]