SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QKQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QKQ9
Domain Number 1 Region: 100-217
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.53e-50
Family Latexin-like 0.000000365
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily Cystatin/monellin 3.06e-36
Family Latexin-like 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QKQ9
Sequence length 222
Comment (tr|G3QKQ9|G3QKQ9_GORGO) Latexin {ECO:0000313|Ensembl:ENSGGOP00000003040} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LXN OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEE
IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEDDNTFYQRLKSMKEPLEAQ
NIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDY
TILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Download sequence
Identical sequences G3QKQ9
ENSGGOP00000003040 XP_004037964.1.27298 ENSGGOP00000003040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]