SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QMS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QMS0
Domain Number 1 Region: 30-204
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.13e-52
Family MHC antigen-recognition domain 0.0000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QMS0
Sequence length 244
Comment (tr|G3QMS0|G3QMS0_GORGO) UL16 binding protein 3 {ECO:0000313|Ensembl:ENSGGOP00000003815} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=ULBP3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAAAASPAVLPRLAILPYLLFDWSGTGRADTHSLWYNFTIIHLPRHGQQWCEVQSQVDQK
NVLSYDCGSDKVLSMGHLEEQLDATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPL
MLQARMSCECEADGCIRGSWQFSFDGQKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLT
TFFKMVSMGDCKSWLRDFLMHRKKRLEPTAPPTVAPGLAQPKAIATTLSPWSFLIILCFI
LPGI
Download sequence
Identical sequences G3QMS0
ENSGGOP00000003815 XP_004044871.1.27298 ENSGGOP00000003815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]