SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QMV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QMV2
Domain Number 1 Region: 269-412
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-33
Family cAMP-binding domain 0.000000205
Further Details:      
 
Domain Number 2 Region: 135-266
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-33
Family cAMP-binding domain 0.000000174
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000719
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QMV2
Sequence length 418
Comment (tr|G3QMV2|G3QMV2_GORGO) Protein kinase cAMP-dependent type II regulatory subunit beta {ECO:0000313|Ensembl:ENSGGOP00000003850} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PRKAR2B OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
VGAAAGGGTPSKGVNFAEEPMHSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH
VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG
EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP
RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Download sequence
Identical sequences G3QMV2
XP_004046069.1.27298 ENSGGOP00000003850 ENSGGOP00000003850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]