SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QMX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QMX9
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.1e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QMX9
Sequence length 219
Comment (tr|G3QMX9|G3QMX9_GORGO) Folliculogenesis specific bHLH transcription factor {ECO:0000313|Ensembl:ENSGGOP00000003878} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=FIGLA OC=Catarrhini; Hominidae; Gorilla.
Sequence
MDPAPGALDPRAAPPALLGAPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENL
QLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDL
LEGAKDSKKQDPDEQSYSNNTSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSS
EPAHTCRQSVMSTTEIISPTRSLDRFPEVELLSHRLPQV
Download sequence
Identical sequences G3QMX9
XP_004029430.1.27298 ENSGGOP00000003878 ENSGGOP00000003878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]