SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QNR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QNR0
Domain Number 1 Region: 535-746
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-52
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 227-372
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-42
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 871-1024
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-33
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 4 Region: 731-856
Classification Level Classification E-value
Superfamily PH domain-like 5.14e-30
Family Pleckstrin-homology domain (PH domain) 0.0067
Further Details:      
 
Domain Number 5 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 7.98e-28
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 6 Region: 46-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-21
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QNR0
Sequence length 1054
Comment (tr|G3QNR0|G3QNR0_GORGO) FERM, ARH/RhoGEF and pleckstrin domain protein 2 {ECO:0000313|Ensembl:ENSGGOP00000004182} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=FARP2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MGEIEGTYRVLQTAGTRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGLEFQNTQSYWIWLEPMKPIVRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKANEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHMSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLAPSGLP
EFKDSSSSLTDPQVSYIKSPAAERSSGAVAGGPNTPSAQPLGPPALQPGPGLSTKSPQPS
PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDYEEPRHKRVPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGSHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAV
YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYTPGHHDYADCHDALKAITEVT
TTLQHILIRLENLQKLTELQRDLVGVENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSD
MLLYTSKGVAGTSHFQIRGLLPLRGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEK
EKWMLDLNSAIQAAKSGGDTTPALPGGTVCTHPPRCPNEVPLEQESEDDARGVRSSLEGH
GQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFF
YKTHQDDYPLASLPLLGYSVSIPREADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEV
IQGASSSAGRAPSIVQDDPQPSSGLEGMVRGKEE
Download sequence
Identical sequences G3QNR0
XP_004033511.1.27298 ENSGGOP00000004182 ENSGGOP00000004182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]