SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QNT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QNT6
Domain Number 1 Region: 86-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QNT6
Sequence length 331
Comment (tr|G3QNT6|G3QNT6_GORGO) Neurogenic differentiation factor {ECO:0000256|PIRNR:PIRNR015618} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NEUROD4 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSKTFVKSKEMGELVNTPSWMDKGLGSQNEMKEEESRPGTYGMLSSLTEEHDSIEEEEEE
EEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSH
LPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFIPHYPSSSLSSGHVHSTPFQA
GTPRYDVPIDMSYDSYPHHGIGTQLNTVFTE
Download sequence
Identical sequences G3QNT6
ENSGGOP00000004212 XP_004053338.1.27298 ENSGGOP00000024563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]