SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QP13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QP13
Domain Number 1 Region: 114-410
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-64
Family Nuclear receptor ligand-binding domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 44-129
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.07e-29
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QP13
Sequence length 410
Comment (tr|G3QP13|G3QP13_GORGO) Nuclear receptor subfamily 2 group E member 3 {ECO:0000313|Ensembl:ENSGGOP00000004296} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NR2E3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
TETRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYG
IYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQN
ERQPRSTAQVRLDSMESNTEPRLESLVVPPAPAGPSPRGPTPISAARALGHHFMASLITA
ETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPV
FSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMET
RVLRETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAH
HPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences G3QP13
ENSGGOP00000004296 ENSGGOP00000004296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]