SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QPE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QPE1
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.79e-41
Family Cofilin-like 0.0028
Further Details:      
 
Domain Number 2 Region: 382-438
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-18
Family SH3-domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QPE1
Sequence length 439
Comment (tr|G3QPE1|G3QPE1_GORGO) Drebrin like {ECO:0000313|Ensembl:ENSGGOP00000004433} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=DBNL OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSG
KVMYTFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMANFLKGTHVTINARAE
EDVEPECIMEKVAKASGANYSFHKESGRFQDAGPQAPVGSVYQKTNAVSEIKRVGKDSFW
AKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQEQGGEASPQSRTWEQ
QQEVVSRNRNEQGSTCASLQESAMHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLT
QPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQ
QQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRG
YGPDGHFGMFPANYVELIE
Download sequence
Identical sequences G3QPE1
ENSGGOP00000004433 XP_018886355.1.27298 ENSGGOP00000004433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]