SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QQQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QQQ6
Domain Number 1 Region: 29-169
Classification Level Classification E-value
Superfamily Cupredoxins 1.03e-48
Family Ephrin ectodomain 0.00000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QQQ6
Sequence length 340
Comment (tr|G3QQQ6|G3QQQ6_GORGO) Ephrin B3 {ECO:0000313|Ensembl:ENSGGOP00000004929} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=EFNB3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDL
LCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEY
SPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAAPRKP
VSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMPAVAGAAGGLALLLL
GVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGG
GAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV
Download sequence
Identical sequences G3QQQ6
XP_004058561.1.27298 ENSGGOP00000004929 ENSGGOP00000004929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]