SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QQR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3QQR0
Domain Number - Region: 57-89
Classification Level Classification E-value
Superfamily EF-hand 0.0404
Family EF-hand modules in multidomain proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QQR0
Sequence length 598
Comment (tr|G3QQR0|G3QQR0_GORGO) EF-hand and coiled-coil domain containing 1 {ECO:0000313|Ensembl:ENSGGOP00000004934} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=EFCC1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEPVSAGAEAGMEGAGGDPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQ
EVFHHLDCRGAGRLPRADFRALCAVLGLRAEGATAAGQAAGDANSRDVTPGDAAAELATD
GDSDTDEEARLALRAEPPELTFRQFHARLCGYFGTRAGPRLPRGALSEHIETQIRLRRPR
RRRRPPCAPGPDSGPDCERVARLEEENSSLRELVEDLRAALQSSDARCLALQVGLWKSQA
STHEMGYGGPEAAVLELRQAQGALAAAEARAGRLRRGQAEVRRRAEEARQVVLRSLDRVR
ELEALAQQVPGLQRWVRRLEAELQRYRSEDSQLPTPQLASPEPGDKSNEPEDAGTRDPDP
TPEGAWQSDSSSGSRALDEVDEQLFRSVEGQAASDEEEVEEERWQEEKKTPAAEAKTLLA
RLSSCRGRCDDQTAEKLMTYFGHFGGADHAHTLGELEACIAMLVEQLRTQGCGGRTLGTS
GEEAELQQKVEENEHLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRDLNISKRALGKI
LLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPASAAAALTNPLLVSC
Download sequence
Identical sequences G3QQR0
ENSGGOP00000004934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]