SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QR51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QR51
Domain Number 1 Region: 124-198
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 3.01e-29
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QR51
Sequence length 200
Comment (tr|G3QR51|G3QR51_GORGO) TSC22 domain family member 3 {ECO:0000313|Ensembl:ENSGGOP00000005087} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TSC22D3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPIVSNFRQLQEKLVFENL
NTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFHSASGASVVAIDNKI
EQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLS
PEEPAPESPQVPEAPGGSAV
Download sequence
Identical sequences G3QR51
XP_018875001.1.27298 XP_018875002.1.27298 XP_018875003.1.27298 ENSGGOP00000005087 ENSGGOP00000023574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]