SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QRH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QRH8
Domain Number 1 Region: 136-312
Classification Level Classification E-value
Superfamily Sec7 domain 7.33e-46
Family Sec7 domain 0.0000983
Further Details:      
 
Domain Number 2 Region: 61-139
Classification Level Classification E-value
Superfamily F-box domain 5.23e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QRH8
Sequence length 319
Comment (tr|G3QRH8|G3QRH8_GORGO) F-box protein 8 {ECO:0000313|Ensembl:ENSGGOP00000005232} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=FBXO8 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKAR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences A0A0S2Z5D1 G1R4L4 G3QRH8 H2PES3 H2RDU5 Q9NRD0
NP_036312.2.87134 NP_036312.2.92137 XP_003258034.1.23891 XP_004040692.1.27298 XP_008975324.1.60992 XP_009238743.1.23681 XP_517540.3.37143 9598.ENSPTRP00000059359 9600.ENSPPYP00000016991 9606.ENSP00000377280 ENSPTRP00000059359 ENSP00000377280 ENSPPYP00000016991 gi|48928044|ref|NP_036312.2| ENSP00000377280 ENSNLEP00000008136 ENSNLEP00000023581 ENSP00000377280 ENSNLEP00000008136 ENSPPYP00000016991 ENSPTRP00000059359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]