SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QSG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QSG9
Domain Number 1 Region: 27-196
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.53e-44
Family Dual specificity phosphatase-like 0.0000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QSG9
Sequence length 212
Comment (tr|G3QSG9|G3QSG9_GORGO) Cyclin-dependent kinase inhibitor 3 {ECO:0000256|PIRNR:PIRNR037322} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CDKN3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLPLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDVFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTICLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPQQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Download sequence
Identical sequences G3QSG9
ENSGGOP00000005606 XP_004055240.1.27298 ENSGGOP00000005606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]