SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QTI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QTI7
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.79e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QTI7
Sequence length 198
Comment (tr|G3QTI7|G3QTI7_GORGO) Heart and neural crest derivatives expressed 2 {ECO:0000313|Ensembl:ENSGGOP00000006012} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HAND2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
FAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDHSH
YGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIK
TLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKK
TKGRTGWPQHVWALELKQ
Download sequence
Identical sequences G3QTI7
ENSGGOP00000006012 ENSGGOP00000006012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]