SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QUH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QUH3
Domain Number 1 Region: 279-465
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-72
Family SPRY domain 0.00000000722
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-24
Family RING finger domain, C3HC4 0.0075
Further Details:      
 
Domain Number 3 Region: 86-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.59e-17
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QUH3
Sequence length 475
Comment (tr|G3QUH3|G3QUH3_GORGO) Tripartite motif containing 21 {ECO:0000313|Ensembl:ENSGGOP00000006375} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TRIM21 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRHRFLL
KNLRPNRQLANMVNNLKEISQEAREGTQEERCAVHGERLHLFCEKDGKALCWVCAQSRKH
RDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAMKRADWKKTVETQKSRIHA
EFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSA
LELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWL
ILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCR
DSVRRKGHFLLSSKSGFWTIWLWNKRKYEAGTYPQTPLHLQVPPCQIGIFLDYEAGMVSF
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY
Download sequence
Identical sequences G3QUH3
ENSGGOP00000006375 XP_004050554.1.27298 ENSGGOP00000006375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]