SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QUL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QUL1
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-129
Family Transglutaminase core 0.00000000705
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 3.32e-41
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 619-717
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-27
Family Transglutaminase, two C-terminal domains 0.0002
Further Details:      
 
Domain Number 4 Region: 506-617
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-27
Family Transglutaminase, two C-terminal domains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QUL1
Sequence length 720
Comment (tr|G3QUL1|G3QUL1_GORGO) Transglutaminase 5 {ECO:0000313|Ensembl:ENSGGOP00000006416} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TGM5 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAQGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFSLTLYFRNRGFQPGLDNIIFV
VETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKIH
IDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCP
WNYGQFEDKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNG
NWSENYTDGANPAEWTGSVAILKQWNATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDT
SSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARSFHGSQRGAELQP
SRPTSLSQDSPRSLHTPSLQPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLK
VNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALG
EEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGS
GLFKKQQKVFLGVLKPQHRASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Download sequence
Identical sequences G3QUL1
XP_004056118.1.27298 ENSGGOP00000006416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]