SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QUN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QUN2
Domain Number 1 Region: 45-298
Classification Level Classification E-value
Superfamily L domain-like 5.27e-41
Family Ngr ectodomain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QUN2
Sequence length 371
Comment (tr|G3QUN2|G3QUN2_GORGO) Leucine rich repeat containing 58 {ECO:0000313|Ensembl:ENSGGOP00000006438} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LRRC58 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEDRRGAREALLRLLLPHNRLVSLP
RALGSGFPHLQLLDVSGNALTALGPELLALRGLRTLLAKNNRLGGPSALPKGLAQSPLCR
SLQVLNFSGNCFQEVPASLLELRALQTLSLGGNQLQSIPAEIENLQSLECLYLGGNFIKE
IPPELGNLPSLNYLVLCDNKIQSVPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
SLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPYDLPGNLLRYLGSASNCPNPK
CGGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASV
AARRMQKVLLG
Download sequence
Identical sequences G3QUN2
XP_018879333.1.27298 ENSGGOP00000006438 ENSGGOP00000006438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]