SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QUX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QUX2
Domain Number 1 Region: 39-136
Classification Level Classification E-value
Superfamily Cystatin/monellin 2.13e-18
Family Cathelicidin motif 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QUX2
Sequence length 211
Comment (tr|G3QUX2|G3QUX2_GORGO) Secreted phosphoprotein 2 {ECO:0000313|Ensembl:ENSGGOP00000006533} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SPP2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVAKVNSQSLSPYL
FRAFRSSLKRVEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTV
KVSAQQVQGVHARCSWSSSTSESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYD
RSLGIMRRVLPPGNRRYPNHRHRARINTDFE
Download sequence
Identical sequences G3QUX2
ENSGGOP00000006533 ENSGGOP00000006533 XP_004033443.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]