SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QV32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QV32
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily EF-hand 6.77e-23
Family S100 proteins 0.0000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QV32
Sequence length 92
Comment (tr|G3QV32|G3QV32_GORGO) S100 calcium binding protein A12 {ECO:0000313|Ensembl:ENSGGOP00000006595} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=S100A12 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTQLEEYLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQG
LDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Download sequence
Identical sequences G3QV32
ENSGGOP00000006595 XP_004026774.1.27298 ENSGGOP00000006595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]