SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QV95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QV95
Domain Number 1 Region: 166-266
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.7e-33
Family GS domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 24-109
Classification Level Classification E-value
Superfamily TPR-like 2.79e-20
Family Tetratricopeptide repeat (TPR) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QV95
Sequence length 365
Comment (tr|G3QV95|G3QV95_GORGO) SGT1 homolog, MIS12 kinetochore complex assembly cochaperone {ECO:0000313|Ensembl:ENSGGOP00000006659} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SUGT1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGN
YCVAVADAKKSLELNPNNSTAMLRKGICEYHGKNYAAALETFTEGQKLDIETGFHRVGQA
GLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTE
SQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLST
KIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPHTRNWDKLVGEIREEEKN
EKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDM
EWKKY
Download sequence
Identical sequences G3QV95
ENSGGOP00000017342 ENSGGOP00000006659 XP_004054610.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]