SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QVC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QVC3
Domain Number 1 Region: 94-204
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.23e-41
Family FAD-dependent thiol oxidase 0.000000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QVC3
Sequence length 205
Comment (tr|G3QVC3|G3QVC3_GORGO) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=GFER OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQALTSDSP
VTEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDL
PTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNQPDTRTRACFTQWLCHLHNEVNRK
LGKPDFDCSKVDERWRDGWKDGSCD
Download sequence
Identical sequences G3QVC3
XP_004057029.1.27298 ENSGGOP00000006687 ENSGGOP00000006687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]