SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QVD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QVD1
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.71e-21
Family THAP domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QVD1
Sequence length 239
Comment (tr|G3QVD1|G3QVD1_GORGO) THAP domain containing 3 {ECO:0000313|Ensembl:ENSGGOP00000006696} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=THAP3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLKAWVLNIGRGNFKPKQHTVICSEHFR
PECFSAFGNRKNLKHNAVPTVFAFQDPTQQVRENTDPASERGNASSSQKEKVLPEAGAGE
DSPGRNMDTALEELQLPPNAEGHVKQVSPRRPQATEAVGRLTGPAGLRTPPNKQPSDHSY
ALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS
Download sequence
Identical sequences G3QVD1
ENSGGOP00000006696 XP_004024618.1.27298 ENSGGOP00000006696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]