SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QVF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QVF4
Domain Number 1 Region: 135-382
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.62e-41
Family Actin/HSP70 0.00037
Further Details:      
 
Domain Number 2 Region: 12-139
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.69e-27
Family Actin/HSP70 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QVF4
Sequence length 417
Comment (tr|G3QVF4|G3QVF4_GORGO) Actin related protein 10 homolog {ECO:0000313|Ensembl:ENSGGOP00000006722} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=ACTR10 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNIN
TEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLL
APSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLL
EQCTVDTSVAKEQSLPSVMGSVPEGVLEDIKARTCFVSDLKRGLKIQAAKFNIDGNNERP
SPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLA
ENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAI
FGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK
Download sequence
Identical sequences G3QVF4 Q9NZ32
NYSGRC-8923712 9606.ENSP00000254286 NP_060947.1.87134 NP_060947.1.92137 XP_018865203.1.27298 ENSP00000254286 gi|8923712|ref|NP_060947.1| ENSP00000254286 ENSP00000254286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]