SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QXY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QXY2
Domain Number 1 Region: 52-103
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000048
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QXY2
Sequence length 387
Comment (tr|G3QXY2|G3QXY2_GORGO) Spermatogenesis and oogenesis specific basic helix-loop-helix 1 {ECO:0000313|Ensembl:ENSGGOP00000007701} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SOHLH1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MASRCSEPDPEVSRVPTVRGCNGSPSGALSCCEDSAQGSGPPKAPTVAEGPSSCLRRNVI
SERERRKRMSLSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASS
KEMWHSLQEDVLQLTLSSQIQAGVPDLGTGVSSGTRTPDVKAFLESPWSLDPSSSTPEPL
PHILASSGQWDPASCTSLGTDQCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRS
PLSWPPFSQQQTLPVMSGEALGWLGQAGPLALGAAPLGEPAEEDPMLAQEAGSALGSDVD
DGTSFLLTAGPSSWPGSLEGRGGSGPAWAPAESSPLDNGEPGFLGDPEPGSQELQDSPLE
PWGLDVDCAGLALKDEVESIFPDFFAC
Download sequence
Identical sequences G3QXY2
ENSGGOP00000007701 XP_004048903.1.27298 ENSGGOP00000007701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]