SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QZ10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QZ10
Domain Number 1 Region: 62-179
Classification Level Classification E-value
Superfamily L domain-like 3.84e-26
Family Ngr ectodomain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QZ10
Sequence length 275
Comment (tr|G3QZ10|G3QZ10_GORGO) Leucine rich repeat containing 3C {ECO:0000313|Ensembl:ENSGGOP00000008108} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LRRC3C OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRMTSSSFVSYCTPGLCQFMAMLPTAGHLLSLLLVIGTGGTVPSPQVPPQGCYVAKEAGE
RTFRCSQAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPALEELDLSHNALAHLSG
AAFQGLEGTLRHLDLSANQLASVPVEAFVGLQIQVNLSANPWHCDCALQEVLRQVRLVPG
TGTGIVCGSGARPDLVGQEFLLLAGEEELCGSGWGGARRSTDVALLVTMGGWLTLVVAYL
VHYVWQNRDETRRSLKRAPVLPMRSEDSSILSTVV
Download sequence
Identical sequences G3QZ10
ENSGGOP00000008108 ENSGGOP00000008108 XP_004041792.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]