SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QZD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QZD3
Domain Number 1 Region: 48-176
Classification Level Classification E-value
Superfamily L domain-like 4.16e-25
Family Ngr ectodomain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QZD3
Sequence length 257
Comment (tr|G3QZD3|G3QZD3_GORGO) Leucine rich repeat containing 3 {ECO:0000313|Ensembl:ENSGGOP00000008240} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LRRC3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MGTVRPPRPLLLLVSTRESCLFLLFCLHLGAACPQPCRCPDHAGAVAVFCSLRGLQEVPE
DIPANTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGPATFAGLAGGLRLLDL
SYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEF
VGKPLVQALDAGASLCSVPHRTTDVAMLVTMFGWFAMVIAYVVYYVRHNQEDARRHLEYL
KSLPSAPASKDPIGPGP
Download sequence
Identical sequences G3QZD3
XP_004062945.1.27298 ENSGGOP00000008240 ENSGGOP00000008240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]