SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R007 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R007
Domain Number 1 Region: 7-101
Classification Level Classification E-value
Superfamily EF-hand 1.54e-28
Family S100 proteins 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3R007
Sequence length 105
Comment (tr|G3R007|G3R007_GORGO) S100 calcium-binding protein {ECO:0000256|RuleBase:RU361184} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=S100A11 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL
DRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Download sequence
Identical sequences A0A2K5PJE5 G1RH69 G3R007 H2N5T5 H2Q002 P31949 V9HWH9
ENSPTRP00000002223 ENSP00000271638 ENSP00000271638 ENSPTRP00000002223 ENSNLEP00000012569 ENSP00000271638 NP_005611.1.87134 NP_005611.1.92137 XP_002810252.1.23681 XP_003259306.1.23891 XP_003339045.1.37143 XP_003817270.1.60992 XP_004026717.1.27298 XP_017353626.1.71028 XP_017375585.1.71028 001007202|e2lucA1|108.1.1.8|A:1-105 001016350|e2lucB1|108.1.1.8|B:1-105 d2luca_ d2lucb_ 2luc_A 2luc_B ENSGGOP00000008482 ENSGGOP00000008482 9598.ENSPTRP00000002223 9600.ENSPPYP00000000990 9606.ENSP00000271638 ENSPPYP00000000990 gi|5032057|ref|NP_005611.1| ENSPPYP00000000990 ENSNLEP00000012569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]