SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R058 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R058
Domain Number 1 Region: 238-347
Classification Level Classification E-value
Superfamily SRCR-like 1.02e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00041
Further Details:      
 
Domain Number 2 Region: 137-241
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00047
Further Details:      
 
Domain Number 3 Region: 21-127
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R058
Sequence length 347
Comment (tr|G3R058|G3R058_GORGO) CD5 molecule like {ECO:0000313|Ensembl:ENSGGOP00000008535} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CD5L OC=Catarrhini; Hominidae; Gorilla.
Sequence
MALLFSLILAIYTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAV
VCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDA
GASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLG
CGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATLQDCPSGPWGKNTCNHDEDTWVECED
PFDLRLVGGDNLCCGRLEVLHKGVWGSVCDDDWGEKEDQVVCKQLGCGKSLSPSFRNRKS
YGPGVGRIWLDNVRCSGEEQSLEQCKHRFWGFHDCTHQEDVAVFCSG
Download sequence
Identical sequences G3R058
XP_018880526.1.27298 ENSGGOP00000008535 ENSGGOP00000008535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]