SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R071 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R071
Domain Number 1 Region: 1104-1243,1300-1588
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.73e-109
Family Myotubularin-like phosphatases 0.00000537
Further Details:      
 
Domain Number 2 Region: 1642-1846
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-31
Family Pleckstrin-homology domain (PH domain) 0.0000247
Further Details:      
 
Domain Number 3 Region: 875-1017
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-17
Family GRAM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R071
Sequence length 1849
Comment (tr|G3R071|G3R071_GORGO) SET binding factor 2 {ECO:0000313|Ensembl:ENSGGOP00000008549} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SBF2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MARLADYFIVVGYDHEKPGSGEGLGKIIQRFPQKDWDDTPFPQGIELFCQPGGWQLSRER
KQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEEIEGGAEVSGLIQPAEVFAPKS
LVLVSRLYYPEIFRACLGLIYTVYVDSLNVSLESLIANLCACLVPAAGGSQKLFSLGAGD
RQLIQTPLHDSLPVTGTSVALLFQQLGIQNVLSLFCAVLTENKVLFHSASFQRLSDACRA
LESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSVFKTDIHELLDVIIADLDGGTI
KIPECIHLSSLPEPLLHQTQSALSLILHPDLEVADHAFPPPRTALSHSKMLDKEVRAVFL
RLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKVLSGMAFAGFVSER
GPPYRSCDLFDELVAFEVERIKVEENNPVKMIKHVRELAEQLFKNENPNPHMAFQKVPRP
TEGSHLRVHILPFPKINEARVQELIQENVAKNQNAPPATRIEKKCVVPAGPPVVSIMDKV
TTVFNSAQRLEVVRNCISFIFENKILETEKTLPAALRALKGKAARQCLTDELGLHVQQNR
AILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAPGVSQFAYTCVQDH
PIWTNQQFWETTFYNAVQEQVRSLYLSAKEDNHAPHLKQKDKLPDDHYQEKTAMDLAAEQ
LRLWPTLSKSTQQELVQHEESTVFSQAIHFANLMVNLLVPLDTSKNKLLRTSAPGDWESG
SNSIVTNSIAGSVAESYDTESGFEDSENNDIANSVVRFITRFIDKVCTESGVTQDHIKSL
HCMIPGIVAMHIETLEAVHRESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDPDGREE
ATGGLLGGPQLLPAEGALFLTTYRILFRGAPHDQLVGEQTVVRSFPIASITKEKKITMQN
QLQQNMQEGLQITSASFQLIKVAFDEEVSPEVVEIFKKQLMKFRYPQSIFSTFAFAAGQT
TPQIILPKQKEKNTSFRTFSKTIVKGAKRAGKMTIGRQYLLKKKTGTIVEERVNRPGWNE
DDDVSVSDESELPTSTTLKASEKSTMEQLVEKACFRDYQRLGLGTISGSSSRSRPEYFRI
TASNRMYSLCRSYPGLLVVPQAVQDSSLPRVARCYRHNRLPVVCWKNSRSGTLLLRSGGF
HGKGVVGLFKSQNSPQAAPTSSLESSSSIEQEKYLQALLNAVSVHQKLRGNSTLTVRPAF
ALSPGVWASLRSSTRLISSPTSFIDVGARLAGKDHSASFSNSTYLQNQLLKRQAALYIFG
EKSQLRNFKVEFALSCEFVPVEFHEIRQVKASFKKLMRACIPSTIPTDSEVTFLKALGDS
EWFPQLHRVMQLAVVVSEVLENGSSVLVCLEEGWDITAQVTSLVQLLSDPFYRTLEGFRM
LVEKEWLSFGHKFSQRSSLTLNCQGSGFAPVFLQFLDCVHQVHNQYPTEFEFNLYYLKFL
AFHYVSNRFKTFLLDSDYERLEHGTLFDDKGEKHAKKGVCIWECIDRMHKRSPIFFNYLY
SPLEIEALKPNVNVSSLKKWDYYIEETLSTGPSYDWMMLTPKHFPSEDSDLAGEAGPRSQ
RRTVWPCYDDVSCTQPDALTSLFSEIEKLEHKLNQAPEKWQQLWERVTVDLKEEPRTDRS
QRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERRAATLYSQYTSKN
DENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPA
GPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQQWMDKIQSCISDA
Download sequence
Identical sequences G3R071
ENSGGOP00000008549 XP_018892813.1.27298 ENSGGOP00000008549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]