SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R0R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R0R9
Domain Number 1 Region: 48-175
Classification Level Classification E-value
Superfamily L domain-like 2.34e-26
Family Ngr ectodomain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R0R9
Sequence length 259
Comment (tr|G3R0R9|G3R0R9_GORGO) Leucine rich repeat containing 3B {ECO:0000313|Ensembl:ENSGGOP00000008763} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LRRC3B OC=Catarrhini; Hominidae; Gorilla.
Sequence
MKLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPR
DLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDL
SDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEH
AGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLK
SLPSRQKKADEPDDISTVV
Download sequence
Identical sequences G3R0R9
ENSGGOP00000008763 XP_004033808.1.27298 XP_018878443.1.27298 XP_018878445.1.27298 XP_018878446.1.27298 XP_018878447.1.27298 ENSGGOP00000008763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]