SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R0U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R0U4
Domain Number 1 Region: 13-161
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-54
Family Dual specificity phosphatase-like 0.0000000644
Further Details:      
 
Domain Number 2 Region: 162-338
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-48
Family Dual specificity phosphatase-like 0.0000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3R0U4
Sequence length 461
Comment (tr|G3R0U4|G3R0U4_GORGO) Cell division cycle 14B {ECO:0000313|Ensembl:ENSGGOP00000008790} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CDC14B OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSREGAGAALVAEVIKDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMV
YRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIF
GETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLN
WIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAG
FDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTA
AETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGV
DDVSINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQS
CKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR
Download sequence
Identical sequences G3R0U4
ENSGGOP00000008790 ENSGGOP00000008790 XP_004048360.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]