SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R0U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R0U5
Domain Number 1 Region: 59-94,220-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-60
Family Nuclear receptor ligand-binding domain 0.000000243
Further Details:      
 
Domain Number 2 Region: 11-84
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.09e-24
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R0U5
Sequence length 461
Comment (tr|G3R0U5|G3R0U5_GORGO) Nuclear receptor subfamily 5 group A member 1 {ECO:0000313|Ensembl:ENSGGOP00000008791} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NR5A1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPAPDYMLPPSLHAPEPKGLATGPPAGPLGDFGAPALPMAVPGAHGPL
AGYLYPAFPGRAIKSEYPEPYASPQQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV
RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVAAQAGSLLHSLVLRAQELVLQLLA
LQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Download sequence
Identical sequences G3R0U5
ENSGGOP00000008791 XP_004048641.1.27298 ENSGGOP00000008791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]