SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R1S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R1S6
Domain Number 1 Region: 3-310
Classification Level Classification E-value
Superfamily CATH 1.6e-141
Family CATH 0.00000000005
Further Details:      
 
Domain Number 2 Region: 704-1047
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.57e-127
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000722
Further Details:      
 
Domain Number 3 Region: 519-696
Classification Level Classification E-value
Superfamily ARM repeat 7.14e-63
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000253
Further Details:      
 
Domain Number 4 Region: 106-296
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.86e-48
Family Ras-binding domain, RBD 0.00039
Further Details:      
 
Domain Number 5 Region: 331-472
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.16e-44
Family PLC-like (P variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3R1S6
Sequence length 1068
Comment (tr|G3R1S6|G3R1S6_GORGO) Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha {ECO:0000313|Ensembl:ENSGGOP00000009158} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PIK3CA OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Download sequence
Identical sequences A0A096MY63 A0A0D9RKI4 A0A2K5IJ73 A0A2K5YVM5 A0A2K6C9I6 G3R1S6 G7NZ32 H9FVU5 K7BQ68 P42336
HR6310 gi|54792082|ref|NP_006209.2| ENSP00000263967 NP_001247597.1.72884 NP_006209.2.87134 NP_006209.2.92137 XP_004038084.1.27298 XP_005546488.1.63531 XP_005546489.1.63531 XP_005546490.1.63531 XP_006713721.1.92137 XP_007970227.1.81039 XP_007970228.1.81039 XP_007970229.1.81039 XP_007970230.1.81039 XP_011511196.1.92137 XP_011753451.1.29376 XP_011753452.1.29376 XP_011753453.1.29376 XP_011814050.1.43180 XP_011835763.1.47321 XP_015301031.1.63531 XP_015301032.1.63531 XP_015301033.1.63531 ENSP00000417479 ENSPTRP00000026912 9598.ENSPTRP00000026912 9606.ENSP00000263967 ENSPANP00000004862 ENSPTRP00000026912 4l1b_A 4l23_A 4l2y_A ENSP00000263967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]