SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R255 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R255
Domain Number 1 Region: 42-124
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.87e-16
Family Cystatins 0.011
Further Details:      
 
Weak hits

Sequence:  G3R255
Domain Number - Region: 124-148
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 0.0366
Family Nqo1C-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R255
Sequence length 159
Comment (tr|G3R255|G3R255_GORGO) Cystatin {ECO:0000256|RuleBase:RU362130} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CST9 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSSPQKRKALPWALSLLLMGFQLLVTYAWCSEEEMGGNNKIVQDPTFLATVEFALNTFNV
QSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQMRQTVCRKFEDDIENCPFQESLE
LNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Download sequence
Identical sequences G3R255
ENSGGOP00000009295 XP_004061951.1.27298 ENSGGOP00000009295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]