SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R284 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R284
Domain Number 1 Region: 288-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-57
Family SPRY domain 0.0000218
Further Details:      
 
Domain Number 2 Region: 4-81
Classification Level Classification E-value
Superfamily RING/U-box 9.28e-21
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000275
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3R284
Sequence length 471
Comment (tr|G3R284|G3R284_GORGO) Tripartite motif containing 60 {ECO:0000313|Ensembl:ENSGGOP00000009327} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TRIM60 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEFVTALVNLQEESSCPICLEYLKDPVTINCGHNFCRSCLNVSWKDLDDTFPCPVCRFCF
PYKSFRRNPQLRNLTEIAKQLWIRRSKRKRRKENAVCEKHNQFLTLFCVKDLEILCTQCS
FSTKHQKHYICPIKKAASYHREILEGSLEPLKNNIERVEKVIILQGSKSVELKKKVEYKR
EEINSEFEQIRLFLQNEQEMILRQIQDEEMNILAKLNENLVELSDYVSTLKHLLREVEGK
SVQSNLELLTHAKSMHHKYQNLKCPELFSFSLTKYGFSLPPQYSGLDRIIKPFQVDVILD
LDTAHPQLLVSEDRRAVRYERKKRNICYDPRRFYVCPAVLGSQRFSSGRHYWEVEVGNKP
KWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSKIGIFLD
YELGDLSFYNMNDRSILYTFNDCFTEAVWPYFYTGTDSEPLKICSVSDSER
Download sequence
Identical sequences G3R284
ENSGGOP00000009327 ENSGGOP00000009327 XP_004040637.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]