SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R2C0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R2C0
Domain Number 1 Region: 80-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.97e-24
Family RecA protein-like (ATPase-domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0000654
Family C-terminal domain of RNA polymerase alpha subunit 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3R2C0
Sequence length 294
Comment (tr|G3R2C0|G3R2C0_GORGO) X-ray repair cross complementing 3 {ECO:0000313|Ensembl:ENSGGOP00000009366} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=XRCC3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MDLDLLDLNPRIIAAIKKAKLKSVKEVLRFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS
SILTALQLHQQKERFPAQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL
CLAVQFPRQHGGLEADTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRA
RHLQSLGAALRELSSAFQSPVLCINQVTEAMDEQGAAHRPLGFWDERVSPALGITWANQL
LVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH
Download sequence
Identical sequences G3R2C0
ENSGGOP00000009366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]