SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R2K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R2K6
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.83e-24
Family Cofilin-like 0.005
Further Details:      
 
Weak hits

Sequence:  G3R2K6
Domain Number - Region: 381-390,548-557
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.012
Family Formin homology 2 domain (FH2 domain) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3R2K6
Sequence length 666
Comment (tr|G3R2K6|G3R2K6_GORGO) Drebrin 1 {ECO:0000313|Ensembl:ENSGGOP00000009460} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=DBN1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
ALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGED
VPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLR
LREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKKALDERLRFEQE
RMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHM
KKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGRPYCPFIKAS
DSGPSSSSSSSSSPPRTPFPYITCHRTPNLSSSLPCSHLDSHRRMAPTPIPTRSPSDSST
ASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEE
PPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATANATEVHGAADAIETDTATADTT
VANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPA
GEGCATLLNFDELPEPPATFCDPEEVEGEPLAAPQIPTLPSALEELEQEQEPEPHLLTNG
ETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEE
GFEGGD
Download sequence
Identical sequences G3R2K6
ENSGGOP00000009460 ENSGGOP00000009460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]