SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R2K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R2K7
Domain Number 1 Region: 569-709
Classification Level Classification E-value
Superfamily PH domain-like 9.02e-47
Family Phosphotyrosine-binding domain (PTB) 0.0000173
Further Details:      
 
Domain Number 2 Region: 425-555
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-21
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R2K7
Sequence length 714
Comment (tr|G3R2K7|G3R2K7_GORGO) Tensin 4 {ECO:0000313|Ensembl:ENSGGOP00000009462} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TNS4 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSQVMSSPLLAGGHAVSLAPCDEPRRTLHPAPSPSLPPQCSYYTTEGWGAQALMAPVPCM
GPPGRLQQAPQAEAKATCFLPSPGEQALGTPEDLDSYIDFSLESLNQMILELDPTFQLLP
PGTGGSQAELAQSTMSMRKKEEPEALDIKYIEVTSARSRCHDGPQHCSSPSVTPPFGSPC
SGGLLSRDVPRETRSSSESLIFSGNQGRGHQRPLPPLEGLSPRPPNSPSISIPCMGSKAS
SPHGLGSPLVASPRLEKRLGGLAPQRGSRISVLSASPVSDVSYMFGSSQSLLHSSNSSHQ
SSSRSLESPANSSSSLHSLGSVSLCMRPSDFQAPRNPTLTMGQPRTPHSPPLAKEHASSC
PPSITNSMVDIPIVLINGCPEPGSSPPQRTPGHQNSVQPGAASPSNPCPATRSHSQTLSD
APFTTCPEGPARDMQPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSYRG
SFGLALRVQEVPASAQNRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQH
SIMALALPCKLTIPQRELGGADGASDSTDSPASCQKKSAGCHTLYLSSVSVETLTGALAV
QKAISTTFERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLTTLRFCGMDPEQRKW
QKYCKPSWIFGFVAKSQTEPQENVCHLFAEYDMVQPASQVIGLVTALLQDAERM
Download sequence
Identical sequences G3R2K7
XP_004041819.1.27298 ENSGGOP00000009462 ENSGGOP00000009462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]