SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R304 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R304
Domain Number 1 Region: 75-252
Classification Level Classification E-value
Superfamily EF-hand 1.24e-48
Family Calmodulin-like 0.000000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R304
Sequence length 256
Comment (tr|G3R304|G3R304_GORGO) Potassium voltage-gated channel interacting protein 3 {ECO:0000313|Ensembl:ENSGGOP00000009619} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=KCNIP3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MQPAKEVTKASDGSLLGDLGHTPLSKKEGVKWQRPRLSRQALMRCCLVKWILSSTAPQGS
DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQ
FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDG
YITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLETCQ
KDENIMSSMQLFENVI
Download sequence
Identical sequences G3R304
XP_018877036.1.27298 ENSGGOP00000009619 ENSGGOP00000009619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]