SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R3A1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R3A1
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000981
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3R3A1
Sequence length 308
Comment (tr|G3R3A1|G3R3A1_GORGO) Hes related family bHLH transcription factor with YRPW motif 1 {ECO:0000313|Ensembl:ENSGGOP00000009725} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HEY1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAH
ALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLG
HIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGS
LGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRP
WGTEIGAF
Download sequence
Identical sequences A0A2J8M9W8 A0A2J8VA05 G3R3A1
gi|105990526|ref|NP_001035798.1| NP_001035798.1.87134 NP_001035798.1.92137 XP_008954913.1.60992 XP_009242170.1.23681 XP_009453814.1.37143 XP_018888431.1.27298 ENSP00000346761 ENSGGOP00000009725 ENSP00000338272 9598.ENSPTRP00000034843 9606.ENSP00000338272 ENSP00000338272 ENSPTRP00000034843 ENSPTRP00000034843 ENSGGOP00000009725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]