SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R3V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R3V9
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-26
Family SH2 domain 0.00000167
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000000379
Family SOCS box-like 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3R3V9
Sequence length 198
Comment (tr|G3R3V9|G3R3V9_GORGO) Suppressor of cytokine signaling 2 {ECO:0000313|Ensembl:ENSGGOP00000009942} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SOCS2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPEAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences G3R3V9 H2Q6L9
ENSPTRP00000009005 XP_004053727.1.27298 XP_009424275.1.37143 XP_009424276.1.37143 XP_009424277.1.37143 XP_009424278.1.37143 ENSGGOP00000009942 ENSPTRP00000009005 9598.ENSPTRP00000009005 ENSGGOP00000009942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]