SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R4F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R4F7
Domain Number 1 Region: 160-347
Classification Level Classification E-value
Superfamily PH domain-like 4.15e-58
Family Phosphotyrosine-binding domain (PTB) 0.000000351
Further Details:      
 
Domain Number 2 Region: 511-612
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-26
Family SH2 domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3R4F7
Sequence length 630
Comment (tr|G3R4F7|G3R4F7_GORGO) SHC adaptor protein 4 {ECO:0000313|Ensembl:ENSGGOP00000010158} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SHC4 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPH
PALAPHLPTEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESRDPGSSGPSSPETSLSRSGTAPPPQQDFVGHRATALTPDSCALPGPGEPTLRSRQDRH
FLQHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
HIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGN
QSSVQPLGSPWHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPALLHSNK
Download sequence
Identical sequences G3R4F7
XP_004056201.1.27298 ENSGGOP00000010158 ENSGGOP00000010158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]