SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R4F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R4F9
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-22
Family PDZ domain 0.00071
Further Details:      
 
Domain Number 2 Region: 280-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000252
Family LIM domain 0.0027
Further Details:      
 
Domain Number 3 Region: 248-279
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000233
Family LIM domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R4F9
Sequence length 330
Comment (tr|G3R4F9|G3R4F9_GORGO) PDZ and LIM domain 4 {ECO:0000313|Ensembl:ENSGGOP00000010162} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PDLIM4 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPS
GTGTGPEDGKPSLVSPYGQPPRFAVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSR
DCRVDLGSEVYRMLREPAEPVAAEPKQSGSFRYLQGMLEAGEGGDWPGPGGPRNLKPTAS
KLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERL
YCESHAKARVKPPEGYDVVAVYPNAKVELV
Download sequence
Identical sequences G3R4F9
ENSGGOP00000010162 ENSGGOP00000010162 XP_004042515.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]