SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R631 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R631
Domain Number 1 Region: 206-323
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 568-724
Classification Level Classification E-value
Superfamily Ras GEF 7.59e-22
Family Ras GEF 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3R631
Sequence length 860
Comment (tr|G3R631|G3R631_GORGO) SH2 domain containing 3C {ECO:0000313|Ensembl:ENSGGOP00000010767} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=SH2D3C OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTEGTKKTSKKFKFFKFKGFGSLSNLPRSFTLRRSSASISRQSHLEPDTFEATQDDMVTV
PRSPPAYARSSDMYSHMGTMPRPSIKKAQNSQAARQAQEAGPKPNLVPGGVPDPPGLEAA
KEVMVKATGPLEDTPAMEPNPSAVEVDPIRKPEVPTGDIEEERPPRDVHSERAAGEPEAG
GDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDF
LIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYH
VGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGPKGSHMKRRSV
TMTDGLTADKVTRSDGCPASTSLPRPRDSIRSCALSMDQIPDLHSPMSPISESPSSPAYS
TVTRVHAAPAAPSATALPASPVARRSSEPQLCPGSAPKTHGESDKGPHTSPSHTLGKASP
SPSLSSYSDPDSGHYCQLQPPVRGSREWAATETSSQQARSYGERLKELSENGAPEGDWGK
TFTVPIMEVTSSFNPATFQSLLIPRDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCL
VARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAVDILGCTGSAEE
RAALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQISRLEQTWVTLRQRHTEGAILYEK
KLKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPPEGPEPWGSTEHGVEVVLAHL
EAARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSSQARRYEKF
DKVLTALSHKLEPAVRSSEL
Download sequence
Identical sequences G3R631
ENSGGOP00000010767 XP_018888893.1.27298 ENSGGOP00000010767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]