SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R650 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R650
Domain Number 1 Region: 163-310
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-44
Family Dual specificity phosphatase-like 0.000000237
Further Details:      
 
Domain Number 2 Region: 7-147
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.08e-19
Family Cell cycle control phosphatase, catalytic domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3R650
Sequence length 314
Comment (tr|G3R650|G3R650_GORGO) Dual specificity protein phosphatase {ECO:0000256|PIRNR:PIRNR000939} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=DUSP2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MGLEAARELECAALGTLLREPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALLRRRAR
GPPAAVLACLLPDRALRTRLARGELARAVVLDEGSASVAELRPDGPAHVLLAALLHETRA
GPTAVYFLRGGFDGFQGCCPDLCSEAPAPALPPTGDKTSRSDPRAPVYDQGGPVEILPYL
FLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAI
GFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSF
MGQLLQFETQVLCH
Download sequence
Identical sequences G3R650
ENSGGOP00000010788 XP_004031463.1.27298 ENSGGOP00000010788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]