SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R6J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R6J6
Domain Number 1 Region: 315-393
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.27e-20
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 81-115
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000214
Family Intermediate filament protein, coiled coil region 0.0025
Further Details:      
 
Domain Number 3 Region: 197-313
Classification Level Classification E-value
Superfamily Prefoldin 0.0000863
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R6J6
Sequence length 468
Comment (tr|G3R6J6|G3R6J6_GORGO) Uncharacterized protein {ECO:0000313|Ensembl:ENSGGOP00000010954} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN= OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSFRLSGGSRRICSRTGSGRLSGGGTGFVAGNVCVGSGAGSSFSCTLGGISSGGSFCNSG
GGLGSGACAVFLGNEHSLLSGNEKVTMQNLNDRLASYLDHVHALEEANADLEQKIKGWYE
KSEPGSSRGHDHDYSRYFSVIEDLKRQIISATICNASIVLQNDNARLTADDFRLKYENEL
ALHHSVEADTNGLRRVLDELTLCTTDLEIQCETLSEELTYLKKSHEEEMEVLQCTAGGNV
NVEMNATPGVDLTVLLNNMRAEYEDMAEQNRKDAEAWFNERSATLQQQISNHEGAATGAR
NELTELKRNLETLEIELQSLMAVKHSYECSLAETEGNYCNQLQQIQDQIGVMEEQLQQIR
TETEGQKLEYEQLLDVKIFLEKEIEIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDS
TEETIFKTVVEELDQIGNLLSLRVHSVEEKSSKISNITVEQRVPSKAP
Download sequence
Identical sequences G3R6J6
ENSGGOP00000010954 ENSGGOP00000010954 XP_018882213.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]